PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10675
Common NameKK1_010984
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 372aa    MW: 41515.6 Da    PI: 8.1016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10675genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
    C.cajan_10675 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding43.95.6e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l++++++ lG++ W+ Ia+ +  gRt++++k+ w++
    C.cajan_10675  67 RGTFSQEEENLIIELHAVLGNR-WSQIAAQLS-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466895.14E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001676.07E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.27166116IPR017930Myb domain
SMARTSM007172.2E-1266114IPR001005SANT/Myb domain
PfamPF002491.1E-1267111IPR001005SANT/Myb domain
CDDcd001671.08E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRWS QIAAQLSGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGEGDKT RSQDSKISTK NDTNLIANCP NKDLFLDSYN TSCQPSDLMG  180
NYPLQITDTL PTNSNSSHWF SPTTAARPFD MNSEFTSNVM SILPPSTTSF LPSTTLCYKP  240
SLAVPSEDIS ISAASFALNG PNYWEANASN SSNGSNTRDG SREMTSGKNS MLSSWGFTEE  300
AKWSEYLHNP MLMLAAPESL CNQIRPATHF VPDGNTLGAI LLPDSKEQQQ QSQTSSIFSK  360
DIQKLTAAFG HI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311850.0KT031185.1 Glycine max clone HN_CCL_13 MYB/HD-like transcription factor (Glyma03g38410.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494877.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A151TXE30.0A0A151TXE3_CAJCA; Transcription factor MYB86
STRINGGLYMA19G41010.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-94myb domain protein 55